PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK13860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 366aa    MW: 41116.7 Da    PI: 9.2097
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK13860.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.49.7e-56161421129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhPtdeel+++yL kkv ++++ + ++i evd++k+ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++lv
  PK13860.1  16 LPPGFRFHPTDEELISHYLYKKVVDTSFLC-RAIGEVDLNKSEPWDLPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYR-GKSLV 113
                79*************************999.88***************888999****************************************.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrle 129
                g+kktLvfykgrapkgek++Wvmheyrle
  PK13860.1 114 GMKKTLVFYKGRAPKGEKSNWVMHEYRLE 142
                ***************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6413166IPR003441NAC domain
PROSITE profilePS5100559.74716166IPR003441NAC domain
PfamPF023652.8E-2917141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MANVIGHVKE GEQLDLPPGF RFHPTDEELI SHYLYKKVVD TSFLCRAIGE VDLNKSEPWD  60
LPWKAKMGEK EWYFFCVRDR KYPTGLRTNR ATEAGYWKAT GKDKEIYRGK SLVGMKKTLV  120
FYKGRAPKGE KSNWVMHEYR LEGKFSVHNL PKTAKNEWVI CRVFQKSSGG KKIPINGLSR  180
LSPLGNEMGP FGLPPLMDSS SPYCNKSKPV FQSMNVPCFS SPINNSNVIR NQDETMVDSL  240
NINSLYGVVS NPLSTNAVLP RTPLPNSLYS DQNAAVSSHM QFPNSYIVPH NNNNGEDQSI  300
LRALVENNGS NLRQIFKTER ETAVNSEVNT SAMADLEMGR RPFGNQVIPT HAATASAGSV  360
DMENFW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-541317214171NO APICAL MERISTEM PROTEIN
1ut4_B1e-541317214171NO APICAL MERISTEM PROTEIN
1ut7_A1e-541317214171NO APICAL MERISTEM PROTEIN
1ut7_B1e-541317214171NO APICAL MERISTEM PROTEIN
3swm_A1e-541317217174NAC domain-containing protein 19
3swm_B1e-541317217174NAC domain-containing protein 19
3swm_C1e-541317217174NAC domain-containing protein 19
3swm_D1e-541317217174NAC domain-containing protein 19
3swp_A1e-541317217174NAC domain-containing protein 19
3swp_B1e-541317217174NAC domain-containing protein 19
3swp_C1e-541317217174NAC domain-containing protein 19
3swp_D1e-541317217174NAC domain-containing protein 19
4dul_A1e-541317214171NAC domain-containing protein 19
4dul_B1e-541317214171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010093594.11e-180NAC domain-containing protein 100
SwissprotQ9FLJ21e-145NC100_ARATH; NAC domain-containing protein 100
TrEMBLW9QTW91e-180W9QTW9_9R
STRINGPOPTR_0015s02170.11e-158(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-146NAC domain containing protein 100